PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G00640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 295aa    MW: 33775.7 Da    PI: 6.0358
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G00640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.43.4e-50231481128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhP+deelv +yL++k +++++ +++++ evd++ +ePwdLp+ +k +++ewyfFs r++kyatg r+nra k+gyWkatgkdk++l+
  OGLUM03G00640.1  23 LPPGFRFHPSDEELVGYYLRNKQQQQQTAATSMLVEVDLHACEPWDLPEVAKVGSDEWYFFSWRERKYATGWRRNRASKQGYWKATGKDKPILH 116
                      79*************************999999***************88888999*************************************9 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++ g +ktLvfy+grap+g+kt Wvmhe+rl
  OGLUM03G00640.1 117 --PTVAGARKTLVFYSGRAPNGRKTAWVMHEFRL 148
                      ..7789**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-5711178IPR003441NAC domain
PROSITE profilePS5100556.50623178IPR003441NAC domain
PfamPF023651.8E-2624148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDGLISDDSM MMGGEVRAIE SRLPPGFRFH PSDEELVGYY LRNKQQQQQT AATSMLVEVD  60
LHACEPWDLP EVAKVGSDEW YFFSWRERKY ATGWRRNRAS KQGYWKATGK DKPILHPTVA  120
GARKTLVFYS GRAPNGRKTA WVMHEFRLLH HHHHPNPNIQ NMQQQEGDDW VLCRVFRKGN  180
NSNGQPLATS SPPAHHLVES LISSPAPTIM SDHDRLFTIQ LPHHQHCDEQ YFFLDDDEQH  240
QQQLLDLSVL QAPTSFESEQ APGHGGMEIN IAEMESFDTT CAALQDASDY CMQLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-462018012170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0704160.0AK070416.1 Oryza sativa Japonica Group cDNA clone:J023051N16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629924.10.0PREDICTED: NAC domain-containing protein 21/22
SwissprotQ84TE67e-62NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A0D9Z0Z50.0A0A0D9Z0Z5_9ORYZ; Uncharacterized protein
STRINGORGLA03G0005100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP169171212
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.13e-61NAC domain containing protein 74